Product Information
26974-1-PBS targets ELMO1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25635 Product name: Recombinant human ELMO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 76-158 aa of BC114341 Sequence: RLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFT Predict reactive species |
| Full Name | engulfment and cell motility 1 |
| Observed Molecular Weight | 80~84 kDa |
| GenBank Accession Number | BC114341 |
| Gene Symbol | ELMO1 |
| Gene ID (NCBI) | 9844 |
| RRID | AB_3742207 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92556 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ELMO1 (Engulfment and cell motility protein 1) is a cytoplasmic adapter protein that physically associates with members of the Dock-A family of Rac-GEFs, of which Dock1 and Dock2 are the best characterized (PMID: 24821968). ELMO1 is expressed in platelets and negatively regulates integrin-mediated platelet spreading. Upregulated ELMO1 expression is associated with a poor prognosis in hepatocellular carcinoma (HCC), as well as increased cell growth, invasion, migration, angiogenesis and EMT in vitro and in vivo (PMID: 31324602).











