ELOVL2 Polyclonal antibody

• 

  IHC staining of human testis using 20308-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 20308-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human hepatocirrhosis using 20308-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human hepatocirrhosis using 20308-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 20308-1-AP (ELOVL2 antibody) at dilution of 1:50 (under 40x lens).

ELOVL2 Polyclonal Antibody for IHC, ELISA

Cat No. 20308-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

ELOVL2, SSC2

---

Tested Applications

• Positive IHC detected in: human testis tissue, human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 3 publications below

Product Information

20308-1-AP targets ELOVL2 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14143

  Product name: Recombinant human ELOVL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-185 aa of BC050278

  Sequence: LLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYS

• Full Name: elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
• Calculated Molecular Weight: 296 aa, 35 kDa
• GenBank Accession Number: BC050278
• Gene Symbol: ELOVL2
• Gene ID (NCBI): 54898
• RRID: AB_10666201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXB9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Cell Dev Biol; ELOVL2 mediated stabilization of AR contributes to enzalutamide resistance in prostate cancer; Authors - Jinpeng Cen
human	IHC	Front Immunol; Insight of a lipid metabolism prognostic model to identify immune landscape and potential target for retroperitoneal liposarcoma; Authors - Zhenyu Wang
mouse	IHC	Cancer Lett; RCC1 regulation of subcellular protein localization via Ran GTPase drives pancreatic ductal adenocarcinoma growth; Authors - Sahar F Bannoura