EMCN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EMCN Polyclonal antibody (34333-1-AP)

• 

  WB analysis using 34333-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34333-1-AP (Endomucin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 34333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 34333-1-AP (Endomucin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 34333-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 34333-1-AP (Endomucin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 34333-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using EMCN antibody (34333-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EMCN Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 34333-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Endomucin, Endomucin-1/2, Muc14, MUC-14, Mucin-14

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, mouse heart tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34333-1-AP targets EMCN in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6353

  Product name: Recombinant mouse Endomucin protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-190 aa of NM_001163522.1

  Sequence: EDGKDVQNDSIPTPAETSTTKASVTIPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEVGTTTEGPLRNESSTMKITVPNTPTSNANSTLPGSQNKTENQSSIRTTEISVTTQLLDALPKITATSSASLTTAHTMSLLQDTEDRKIATTPSTTPSYSS

• Full Name: endomucin
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 70-90 kDa
• GenBank Accession Number: NM_001163522.1
• Gene Symbol: Emcn
• Gene ID (NCBI): 59308
• RRID: AB_3743192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9R0H2-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Endomucin (EMCN), also known as Endomucin 2 or Mucin 14, is a type I integral membrane glycoprotein that is endothelial-specific. EMCN is expressed on the surface of capillaries and venous and is highly expressed in highly vascularized tissues such as heart, kidney and lung (PMID: 29215001). Endomucin plays an important role in cell interaction, molecular cell signaling, angiogenesis and cell migration (PMID: 33532708). Since it is glycosylated, the apparent molecular weight of EMCN could be variable, ranging from 70 kDa to 120 kDa.