EMCN Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EMCN Monoclonal antibody (67854-1-Ig)

EMCN Monoclonal Antibody for WB, ELISA

Cat No. 67854-1-Ig Copied!

Clone No. 2D8G3

Publications (12)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse and More (4)

Applications

WB, IHC, IF, ELISA

Synonyms

EMCN, EMCN2, endomucin, Endomucin 2, Gastric cancer antigen Ga34, MUC 14, MUC14, Mucin 14

• 

  WB analysis of HUVEC using 67854-1-Ig

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of bEnd.3 using 67854-1-Ig

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EMCN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells, bEnd.3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67854-1-Ig targets EMCN in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31146

  Product name: Recombinant human EMCN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC017781

  Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN

• Full Name: endomucin
• Calculated Molecular Weight: 19 kDa, 27 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC017781
• Gene Symbol: EMCN
• Gene ID (NCBI): 51705
• RRID: AB_2918612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9ULC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EMCN Monoclonal antibody (catalog number 67854-1-Ig) has 12 total citations. These appear in journals including Advanced Science, Materials Today Bio, Biochemical Pharmacology, ACS Biomaterials Science & Engineering, Communications Biology, European Journal of Pharmacology, Frontiers in Cell and Developmental Biology, Journal of Cellular and Molecular Medicine, Cell Signaling, and BMC Musculoskeletal Disorders. The associated research fields center on angiogenesis, bone regeneration, osteoarthritis, osteoporosis, and inflammation, with applications in immunohistochemistry, immunofluorescence, and Western blot.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); THBS1(+) Macrophages Exacerbate Modic Changes via SDC4-Dependent Activation of NLRP3 Inflammasome.; Authors - Xiangxi Kong
rat	IF	Mater Today Bio; Human urine-derived stem cell exosomes delivered via injectable GelMA templated hydrogel accelerate bone regeneration; Authors - Wei Lu
rat	IHC,IF	Mater Today Bio; Pressure-sensitive composite bandages with high toughness, self-healability and strong tissues adhesion for rapid bone fixation and accelerated osteogenesis via immunomodulation and neovascularization.; Authors - Puzhou Lei
		Mater Today Bio; Photocontrolled biomimetic PEEK scaffold with black phosphorus-strontium ion cascade release for vascularized bone regeneration.; Authors - Fang Guo
mouse	IF	Biochem Pharmacol; NMN prevents obesity-induced osteoporosis by promoting mitophagy to restore type H vessels.; Authors - Meng Shen
rabbit	WB	ACS Biomater Sci Eng; An Experimental Study on 3D-Printed Gyroid-Shaped TC4 Porous Scaffolds Guiding Angiogenesis and Osteogenesis in Bone Defect Areas.; Authors - Lei Wang