EMCN Monoclonal antibody

• 

  WB analysis of HUVEC using 67854-1-Ig

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of bEnd.3 using 67854-1-Ig

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

EMCN Monoclonal Antibody for WB, ELISA

Cat No. 67854-1-Ig

Clone No.2D8G3

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse and More (3)

Applications

WB, IF, ELISA

Synonyms

EMCN, EMCN2, endomucin, Endomucin 2, Gastric cancer antigen Ga34, MUC 14, MUC14, Mucin 14

---

Tested Applications

• Positive WB detected in: HUVEC cells, bEnd.3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 3 publications below

Product Information

67854-1-Ig targets EMCN in WB, IF, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31146

  Product name: Recombinant human EMCN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC017781

  Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN

• Full Name: endomucin
• Calculated Molecular Weight: 19 kDa, 27 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC017781
• Gene Symbol: EMCN
• Gene ID (NCBI): 51705
• RRID: AB_2918612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9ULC0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Mol Med; Human serum-derived exosomes modulate macrophage inflammation to promote VCAM1-mediated angiogenesis and bone regeneration; Authors - Xi Xiang
mouse	IF	Cell Signal; Forkhead box C1 promotes the pathology of osteoarthritis in subchondral bone osteoblasts via the Piezo1/YAP axis; Authors - Zhengyuan Li
rat	IF	Commun Biol; Piezo1 promotes vibration-induced vascular smooth muscle injury by regulating the NF-κB/p65 axis; Authors - Yingshan Zeng
rat	IF	Mater Today Bio; Human urine-derived stem cell exosomes delivered via injectable GelMA templated hydrogel accelerate bone regeneration; Authors - Wei Lu