EMCN Monoclonal antibody, PBS Only

• 

  WB analysis of HUVEC using 67854-1-Ig (same clone as 67854-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67854-1-PBS in a different storage buffer formulation.

• 

  WB analysis of bEnd.3 using 67854-1-Ig (same clone as 67854-1-PBS)

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 67854-1-Ig (EMCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67854-1-PBS in a different storage buffer formulation.

EMCN Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67854-1-PBS

Clone No.2D8G3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, Indirect ELISA

Synonyms

EMCN, EMCN2, endomucin, Endomucin 2, Gastric cancer antigen Ga34, MUC 14, MUC14, Mucin 14

---

Product Information

67854-1-PBS targets EMCN in WB, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31146

  Product name: Recombinant human EMCN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC017781

  Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN

• Full Name: endomucin
• Calculated Molecular Weight: 19 kDa, 27 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC017781
• Gene Symbol: EMCN
• Gene ID (NCBI): 51705
• RRID: AB_2918612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9ULC0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.