EMILIN2 Polyclonal antibody

• 

  IHC staining of human lung cancer using 24779-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24779-1-AP (EMILIN2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human lung cancer using 24779-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24779-1-AP (EMILIN2 Antibody) at dilution of 1:200 (under 40x lens).

EMILIN2 Polyclonal Antibody for IHC, ELISA

Cat No. 24779-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

EMILIN 2, EMILIN2, FOAP 10, Protein FOAP 10

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

24779-1-AP targets EMILIN2 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20722

  Product name: Recombinant human EMILIN2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 704-1053 aa of BC136541

  Sequence: GRVSHMEKTCSKLDSISGNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVFQISTDLQDLVKFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPGSTGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGAPVPSLVSFSAGLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQLHTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAVNVVVTGGKLAHTDFDEMYSTFSGVFLYPFLSHL

• Full Name: elastin microfibril interfacer 2
• Calculated Molecular Weight: 1053 aa, 116 kDa
• GenBank Accession Number: BC136541
• Gene Symbol: EMILIN2
• Gene ID (NCBI): 84034
• RRID: AB_2879716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXX0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Transl Med; Identifying prognostic markers in spatially heterogeneous breast cancer microenvironment; Authors - Guohong Liu