EMR2/CD312 Recombinant monoclonal antibody

• 

  WB analysis using 84608-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84608-5-RR (EMR2/CD312 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 84608-5-RR

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using EMR2/CD312 antibody (84608-5-RR, Clone: 242042E3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84608-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84608-5-RR against Human EMR2 were performed. The affinity constant is 1.45 nM.

EMR2/CD312 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84608-5-RR

Clone No.242042E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

EMR2, 242042E3, ADGRE2, Adhesion G protein-coupled receptor E2, CD312

---

Tested Applications

• Positive WB detected in: HeLa cells, THP-1 cells, L02 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84608-5-RR targets EMR2/CD312 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2479

  Product name: Recombinant Human EMR2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-260 aa of NM_013447.3

  Sequence: QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCE

• Full Name: egf-like module containing, mucin-like, hormone receptor-like 2
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 75~90 kDa
• GenBank Accession Number: NM_013447.3
• Gene Symbol: EMR2
• Gene ID (NCBI): 30817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UHX3-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EMR2 (Epidermal Growth Factor-like module-containing Mucin-like Hormone Receptor 2), also known as ADGRE2, is a member of the adhesion-GPCR family that contains extracellular EGF-like domains. EMR2 contains a total of five tandem EGF-like domains and expresses similar protein isoforms consisting of various numbers of EGF-like domains as a result of alternative RNA splicing (PMID: 10903844). EMR2 is restricted to myeloid cells including monocytes, macrophages, dendritic cells and granulocytes28 and its expression is highly regulated during monocyte/macrophage differentiation (PMID: 31969668).The ligation of EMR2 could increase neutrophil adhesion, migration and anti-microbial mediator production and could enhance the systemic inflammation (PMID: 27905560).