ENGASE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ENGASE Polyclonal antibody, PBS Only (31784-1-PBS)

• 

  IHC staining of mouse spleen using 31784-1-AP (same clone as 31784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31784-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 31784-1-AP (same clone as 31784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31784-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse thymus using 31784-1-AP (same clone as 31784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31784-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse thymus using 31784-1-AP (same clone as 31784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 31784-1-AP (ENGASE antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31784-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 31784-1-AP (same clone as 31784-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using ENGASE antibody (31784-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31784-1-PBS in a different storage buffer formulation.

ENGASE Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31784-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

EC:3.2.1.96, Cytosolic endo-beta-N-acetylglucosaminidase

---

Product Information

31784-1-PBS targets ENGASE in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34633

  Product name: Recombinant human ENGASE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_001042573

  Sequence: IKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGR

• Full Name: endo-beta-N-acetylglucosaminidase
• Calculated Molecular Weight: 84 kDa
• GenBank Accession Number: NM_001042573
• Gene Symbol: ENGASE
• Gene ID (NCBI): 64772
• RRID: AB_3670113
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NFI3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Endo-β-N-acetylglucosaminidase (ENGASE) is an enzyme that belongs to glycoside hydrolase (GH) families 18 and 85, and is widely distributed in bacteria, fungi, and higher-order species. ENGASE hydrolyzes the β1-4 linkage of the N, N-diacetylchitobiose (GlcNAcβ1-4GlcNAc) region of the N-linked glycans present on glycoproteins (PMID: 36435009). ENGASE is widely expressed, with higher expression in thymus and spleen (Refer to Uniprot).