ENPP4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ENPP4 Polyclonal antibody, PBS Only (17305-1-PBS)

• 

  WB analysis of HL-60 using 17305-1-AP (same clone as 17305-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17305-1-AP (ENPP4 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17305-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 17305-1-AP (same clone as 17305-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17305-1-AP (ENPP4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17305-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17305-1-AP (same clone as 17305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17305-1-AP (ENPP4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17305-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17305-1-AP (same clone as 17305-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17305-1-AP (ENPP4 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17305-1-PBS in a different storage buffer formulation.

ENPP4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17305-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17305-1-PBS targets ENPP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11192

  Product name: Recombinant human ENPP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-350 aa of BC018054

  Sequence: LPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLA

• Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative function)
• Calculated Molecular Weight: 453 aa, 52 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC018054
• Gene Symbol: ENPP4
• Gene ID (NCBI): 22875
• RRID: AB_2099780
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6X5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ENPP4, also named as KIAA0879 or NPP4, is a 453 amino acid protein, which belongs to the nucleotide pyrophosphatase/phosphodiesterase family. ENPP4 localizes in the cell membrane and hydrolyzes extracellular Ap3A into AMP and ADP, and Ap4A into AMP and ATP. ENPP4 is expressed on the surface of vascular endothelia.