ENT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ENT1 Polyclonal antibody, PBS Only (29862-1-PBS)

• 

  WB analysis using 29862-1-AP (same clone as 29862-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29862-1-AP (ENT1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 29862-1-AP (same clone as 29862-1-PBS)

  WB result of ENT1 antibody (29862-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ENT1 transfected HeLa cells. This data was developed using the same antibody clone with 29862-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29862-1-AP (same clone as 29862-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29862-1-AP (ENT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 29862-1-AP (same clone as 29862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 29862-1-AP (ENT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 29862-1-AP (same clone as 29862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 29862-1-AP (ENT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29862-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ENT1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29862-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ENT-1, Equilibrative NBMPR-sensitive nucleoside transporter, Equilibrative nitrobenzylmercaptopurine riboside-sensitive nucleoside transporter, es nucleoside transporter, Nucleoside transporter, es-type

---

Product Information

29862-1-PBS targets ENT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32003

  Product name: Recombinant human ENT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-82 aa of NM_001372327.1

  Sequence: NFFMTATQYFTNRLDMSQNVSLVTAELSKDAQASAAPAAPLPERNSLSAIFNN

• Full Name: solute carrier family 29 (nucleoside transporters), member 1
• Calculated Molecular Weight: 50KD
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001372327.1
• Gene Symbol: ENT1
• Gene ID (NCBI): 2030
• RRID: AB_2935484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99808
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ENT1 (equilibrative nucleoside transporter 1; also known as SLC29A1) is a ubiquitous protein located at the cell membrane and is a major transporter responsible for the cellular uptake and release of endogenous nucleosides such as adenosine, and nucleoside analogs used in chemotherapy. The predicted molecular weight of ENT1 is 50 kDa, while heavier 54-68 kDa band may be observed due to the glycosylation (PMID: 16448802, 11850433, 16111480). A smaller novel splice variant of the mouse ENT1 has also been identified, which generates a protein of 35-40 kDa (PMID: 18413666).