ENTPD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ENTPD3 Polyclonal antibody (13021-1-AP)

ENTPD3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13021-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

Ecto-ATPase 3, Ecto-ATP diphosphohydrolase 3, Ecto-apyrase 3, EC:3.6.1.5, CD39L3

• 

  WB analysis of human brain using 13021-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13021-1-AP (ENTPD3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 13021-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13021-1-AP (ENTPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 13021-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13021-1-AP (ENTPD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 13021-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using ENTPD3 antibody (13021-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ENTPD3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, Jurkat cells, Raji cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13021-1-AP targets ENTPD3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4114

  Product name: Recombinant human ENTPD3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 45-366 aa of BC029869

  Sequence: IHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGP

• Full Name: ectonucleoside triphosphate diphosphohydrolase 3
• Calculated Molecular Weight: 529 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC029869
• Gene Symbol: ENTPD3
• Gene ID (NCBI): 956
• RRID: AB_2100082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75355
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ENTPD3, also known as NTPDase3 or CD39L3, belongs to the GDA1/CD39 NTPase family. ENTPD3 has a threefold preference for the hydrolysis of ATP over ADP. ENTPD3 is expressed in adult brain, pancreas, spleen and prostate, but not in liver and peripheral blood leukocytes. ENTPD3 has 2 isoforms with the molecular mass of 51 and 59 kDa.

Publications

What published studies show

The ENTPD3 Polyclonal antibody (Cat# 13021-1-AP) has 4 citations published in Nature Communications, Cell Communication and Signaling, Reproductive Sciences, and Cell Molecular Biology Letters. The research spans neuroscience (astrocyte calcium signaling in autism spectrum disorder), tumor immunology (exosomal ENTPD2 in colon cancer), reproductive biology (ENTPD3 hormonal regulation in mouse uterus), and endometrial receptivity (ENTPD3 in recurrent implantation failure). All cited applications are Western blot.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Impaired calcium signaling in astrocytes modulates autism spectrum disorder-like behaviors in mice.; Authors - Qian Wang
	WB	Cell Commun Signal; Tumor derived exosomal ENTPD2 impair CD8+ T cell function in colon cancer through ATP-adenosine metabolism reprogramming; Authors - Mengchen Shi
mouse	WB	Reprod Sci; Expression and Hormonal Regulation of Entpd3 at Various Estrous Cycle Stages in the Mouse Uterus; Authors - Dan Mo
		Cell Mol Biol Lett; ENTPD3 as a novel regulator of endometrial receptivity: suppressing EMT via the ATP-P2Y2 axis in patients with recurrent implantation failure.; Authors - Dan Mo