EOMES/TBR2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83945-5-RR (same clone as 83945-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83945-5-RR (EOMES antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83945-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83945-5-RR (same clone as 83945-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83945-5-RR (EOMES/TBR2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83945-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83945-5-RR (same clone as 83945-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83945-5-RR (EOMES/TBR2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83945-5-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 83945-5-PBS

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83945-5-PBS (EOMES/TBR2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 83945-5-PBS

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83945-5-PBS (EOMES/TBR2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 83945-5-RR (same clone as 83945-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using EOMES antibody (83945-5-RR, Clone: 241036D9 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83945-5-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 83945-5-RR (same clone as 83945-5-PBS)

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug EOMES/TBR2 Recombinant monoclonal antibody (83945-5-RR, Clone:241036D9) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83945-5-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 83945-5-PBS

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug EOMES/TBR2 Recombinant monoclonal antibody, PBS Only (83945-5-PBS, Clone:241036D9) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83945-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83945-5-RR against Human EOMES were performed. The affinity constant is below 1 pM.

EOMES/TBR2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83945-5-PBS

Clone No.241036D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

EOMES, TBR2, 241036D9, Eomesodermin homolog, T box brain protein 2

---

Tested Applications

• Positive IHC detected in: rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83945-5-PBS targets EOMES/TBR2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27634

  Product name: Recombinant human EOMES protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 575-676 aa of NM_001278182

  Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM

• Full Name: eomesodermin homolog (Xenopus laevis)
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: NM_001278182
• Gene Symbol: EOMES
• Gene ID (NCBI): 8320
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95936
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880).