CoraLite® Plus 488-conjugated EOMES/TBR2 Recombinant monoclonal antibody

EOMES/TBR2 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83945-5
Clone No.241036D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

EOMES, TBR2, 241036D9, Eomesodermin homolog, T box brain protein 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83945-5 targets EOMES/TBR2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27634

Product name: Recombinant human EOMES protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 575-676 aa of NM_001278182

Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM

Predict reactive species
Full Name eomesodermin homolog (Xenopus laevis)
Calculated Molecular Weight 73 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberNM_001278182
Gene Symbol EOMES
Gene ID (NCBI) 8320
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95936
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 EOMES/TBR2 antibody CL488-83945-5Download protocol
IF protocol for CL Plus 488 EOMES/TBR2 antibody CL488-83945-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...