FcZero-rAb® APC Anti-Human EPCAM/CD326 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Human EPCAM/CD326 Rabbit Recombinant Antibody (APC-FcA98303-5)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

EPCAM/CD326 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98303-5

Clone No.250626C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

EPCAM, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1, CO 17A

• 

  FC experiment of HT-29 using APC-FcA98303-5

  1x10^6 HT-29 cells(left) or HeLa cells (right) were surface stained with 5 ul APC Anti-Human EPCAM/CD326 Rabbit RecAb (APC-FcA98303-5, Clone: 250626C6) (red) or FcZero-rAb® APC Rabbit IgG Isotype Control Recombinant Antibody (APC-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: HT-29 cells

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98303-5 targets EPCAM/CD326 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1370

  Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-265 aa of NM_002354.3

  Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Full Name: epithelial cell adhesion molecule
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_002354.3
• Gene Symbol: EPCAM
• Gene ID (NCBI): 4072
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)