CoraLite® Plus 488 Anti-Human EPCAM/CD326 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488 Anti-Human EPCAM/CD326 Rabbit scFv Antibody (CL488-SF98303-5)

• Site-specific conjugation

EPCAM/CD326 Recombinant Antibody for FC

Cat No. CL488-SF98303-5

Clone No.250626C6

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

EPCAM, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1, CO 17A

• 

  FC experiment of HT-29 using CL488-SF98303-5

  1x10^6 HT-29 cells (left) or HeLa cells (right) were surface stained with 0.25 ug Coralite® Plus 488 CoraLite® Plus 488 Anti-Human EPCAM/CD326 Rabbit scFv Antibody (CL488-SF98303-5, Clone: 250626C6) (red) or 0.25 ug CoraLite® Plus 488 Rabbit scFv Isotype Control (CL488-SF98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: HT-29 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98303-5 targets EPCAM/CD326 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg1370

  Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-265 aa of NM_002354.3

  Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

• Full Name: epithelial cell adhesion molecule
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_002354.3
• Gene Symbol: EPCAM
• Gene ID (NCBI): 4072
• RRID: AB_3748011
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Source: Anti-Human EPCAM/CD326 scFv from clone 250626C6, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin 300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)