CoraLite® Plus 555-conjugated EPCAM/CD326 Recombinant monoclonal antibody

EPCAM/CD326 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL555-84073-6
Clone No.241243B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

EPCAM, 241243B10, Adenocarcinoma-associated antigen, CD326, Cell surface glycoprotein Trop-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-84073-6 targets EPCAM/CD326 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1370

Product name: Recombinant Human EpCAM/CD326 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 24-265 aa of NM_002354.3

Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Predict reactive species
Full Name epithelial cell adhesion molecule
Calculated Molecular Weight35 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberNM_002354.3
Gene Symbol EPCAM
Gene ID (NCBI) 4072
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16422
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Epithelial cell adhesion molecule (EpCAM, CD326) is a type I transmembrane glycoprotein that functions as a homophilic, epithelial-specific intercellular cell-adhesion molecule. In addition to cell adhesion, EpCAM is also involved in cellular signaling, cell migration, proliferation, and differentiation. EpCAM is highly expressed on most carcinomas and therefore of potential use as a diagnostic and prognostic marker for a variety of carcinomas, and has become a therapeutic target. EpCAM may occur in distinct forms due to glycosylation. (PMID: 20837599; 19249674; 21576002; 22647938; 12691820)

Protocols

Product Specific Protocols
IF protocol for CL Plus 555 EPCAM/CD326 antibody CL555-84073-6Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...