EPG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPG5 Polyclonal antibody, PBS Only (27666-1-PBS)

• 

  WB analysis using 27666-1-AP (same clone as 27666-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 27666-1-AP (EPG5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27666-1-AP (same clone as 27666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27666-1-AP (KIAA1632 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 27666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27666-1-AP (same clone as 27666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27666-1-AP (KIAA1632 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 27666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 27666-1-AP (same clone as 27666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27666-1-AP (EPG5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27666-1-PBS in a different storage buffer formulation.

EPG5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27666-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

HEEW1, KIAA1632, UPF0493 protein KIAA1632

---

Product Information

27666-1-PBS targets EPG5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24801

  Product name: Recombinant human KIAA1632 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2112-2462 aa of BC130614

  Sequence: ETRSMIVCLLFMMILLAKEVQLVDQTDSPLLSLLGQTSSLSWHLVDIVSYQSVLSYFSSHYPPSIILAKESYAELIMKLLKVSAGLSIPTDSQKHLDAVPKCQAFTHQMVQFLSTLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDSQTRHMALSSLFMEVLMMMNNATIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAYFKESPLNQNSGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILSKWLEQVYPSSVEEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEERL

• Full Name: KIAA1632
• Calculated Molecular Weight: 2579 aa, 292 kDa
• Observed Molecular Weight: 270-290 kDa
• GenBank Accession Number: BC130614
• Gene Symbol: EPG5
• Gene ID (NCBI): 57724
• RRID: AB_3085981
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCE0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPG5, a metazoan-specific autophagy protein, regulates autophagy by promoting fusion of autophagosomes with lysosomes and/or late endosomes. EPG5 regulates the stability and the assembly of STX17-SNAP29-VAMP8 trans-SNARE complexes. Loss of function of EPG5 causes non-specific fusion of autophagosomes with other endocytic vesicles, resulting in formation of non-degradative enlarged vesicles. EPG5 expression in human pluripotent stem cells like ESC and iPSC is higher than that of human somatic cells.(PMID: 30931944, PMID: 27588602)