EPHA2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• EPHA2 Recombinant monoclonal antibody (87904-1-RR)

EPHA2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87904-1-RR

Clone No.253572H2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, ELISA

Synonyms

EC:2.7.10.1, Eck, Ephrin type-A receptor 2, Epithelial cell kinase, Myk2

• 

  WB analysis using 87904-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87904-1-RR (EPHA2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 87904-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using EPHA2 antibody (87904-1-RR, Clone: 253572H2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87904-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87904-1-RR against Mouse EPHA2 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: L-929 cells, NIH/3T3 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87904-1-RR targets EPHA2 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg8778

  Product name: Recombinant mouse Epha2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 26-538 aa of NM_010139.3

  Sequence: KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSANMAV

• Full Name: Eph receptor A2
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_010139.3
• Gene Symbol: Epha2
• Gene ID (NCBI): 13836
• RRID: AB_3745819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q03145
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPH receptor A2 (EPHA2) is a receptor tyrosine kinase (RTK) of the Eph receptor family that primarily binds glycosylphosphatidylinositol (GPI)-anchored ephrin-A ligands, especially ephrin-A1 (EFNA1), to mediate contact-dependent cell-cell signaling. In mice, Epha2 is broadly expressed in epithelial, endothelial, and selected stromal compartments, where it regulates cell adhesion, polarity, migration, proliferation, barrier organization, and tissue architecture.