• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated EPHA2 Monoclonal antibody

EPHA2 Monoclonal Antibody for
Cat No. CL488-66736
Clone No.1A9C3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

EPHA2, Ephrin type A receptor 2, Ephrin type-A receptor 2, Epithelial cell kinase, Tyrosine-protein kinase receptor ECK, 1A9C3, EC:2.7.10.1, ECK, EPH receptor A2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66736 targets EPHA2 in applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22566

Product name: Recombinant human EPHA2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 271-535 aa of BC037166

Sequence: DACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNL

Predict reactive species
Full Name EPH receptor A2
Calculated Molecular Weight 976 aa, 108 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC037166
Gene Symbol EPHA2
Gene ID (NCBI) 1969
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP29317
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ephrin type-A receptor 2 (EPHA2), belongs to the receptor tyrosine kinases (RTKs) family, that binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Research studies have shown that Eph receptors and ligands may be involved in many diseases including cancer (PMID: 11114742). The "reverse signaling" function, whereby the cytoplasmic domain becomes tyrosine phosphorylated, allows interactions with other proteins that may activate signaling pathways in the ligand-expressing cells.

Loading...
||
New chat Able
正在加载,请稍候...