EPHA8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPHA8 Polyclonal antibody, PBS Only (13724-1-PBS)

• 

  WB analysis of mouse brain using 13724-1-AP (same clone as 13724-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13724-1-AP (EPHA8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13724-1-PBS in a different storage buffer formulation.

EPHA8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13724-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13724-1-PBS targets EPHA8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4503

  Product name: Recombinant human EPHA8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-350 aa of BC038796

  Sequence: LDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAP

• Full Name: EPH receptor A8
• Calculated Molecular Weight: 1005 aa, 111 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC038796
• Gene Symbol: EPHA8
• Gene ID (NCBI): 2046
• RRID: AB_10638906
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29322
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.