EPHB2 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPHB2 Monoclonal antibody, PBS Only (60908-3-PBS)

• 

  WB analysis using 60908-3-Ig (same clone as 60908-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60908-3-Ig (EPHB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60908-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60908-3-Ig (same clone as 60908-3-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60908-3-Ig (EPHB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60908-3-PBS in a different storage buffer formulation.

EPHB2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 60908-3-PBS

Clone No.2F3H9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

Synonyms

CAPB, Developmentally-regulated Eph-related tyrosine kinase, DRT, EC:2.7.10.1, EK5

---

Product Information

60908-3-PBS targets EPHB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28796

  Product name: Recombinant human EPHB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 886-986 aa of BC018763

  Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

• Full Name: EPH receptor B2
• Calculated Molecular Weight: 987 aa, 108 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC018763
• Gene Symbol: EPHB2
• Gene ID (NCBI): 2048
• RRID: AB_3743240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29323
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPHB2 is a receptor tyrosine kinase that mediates ephrin-dependent bidirectional signaling to control cell positioning, boundary formation, and tissue architecture. Expressed in the nervous system and intestinal epithelium, EPHB2 regulates axon guidance, synaptic plasticity, and epithelial organization. Loss or dysregulation of EPHB2 contributes to colorectal cancer progression and altered neural connectivity, underscoring its central role in developmental patterning and tissue homeostasis.