Product Information
60908-3-PBS targets EPHB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28796 Product name: Recombinant human EPHB2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species |
| Full Name | EPH receptor B2 |
| Calculated Molecular Weight | 987 aa, 108 kDa |
| Observed Molecular Weight | 110-120 kDa |
| GenBank Accession Number | BC018763 |
| Gene Symbol | EPHB2 |
| Gene ID (NCBI) | 2048 |
| RRID | AB_3743240 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P29323 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
EPHB2 is a receptor tyrosine kinase that mediates ephrin-dependent bidirectional signaling to control cell positioning, boundary formation, and tissue architecture. Expressed in the nervous system and intestinal epithelium, EPHB2 regulates axon guidance, synaptic plasticity, and epithelial organization. Loss or dysregulation of EPHB2 contributes to colorectal cancer progression and altered neural connectivity, underscoring its central role in developmental patterning and tissue homeostasis.



