EPHB2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EPHB2 Monoclonal antibody (60908-3-Ig)

• 

  WB analysis using 60908-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60908-3-Ig (EPHB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60908-3-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60908-3-Ig (EPHB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

EPHB2 Monoclonal Antibody for WB, ELISA

Cat No. 60908-3-Ig

Clone No.2F3H9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, ELISA

Synonyms

CAPB, Developmentally-regulated Eph-related tyrosine kinase, DRT, EC:2.7.10.1, EK5

---

Tested Applications

• Positive WB detected in: Saos-2 cells, HeLa cells, U2OS cells, rat brain tissue, mouse brain tissue, rabbit brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60908-3-Ig targets EPHB2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28796

  Product name: Recombinant human EPHB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 886-986 aa of BC018763

  Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

• Full Name: EPH receptor B2
• Calculated Molecular Weight: 987 aa, 108 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC018763
• Gene Symbol: EPHB2
• Gene ID (NCBI): 2048
• RRID: AB_3743240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29323
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPHB2 is a receptor tyrosine kinase that mediates ephrin-dependent bidirectional signaling to control cell positioning, boundary formation, and tissue architecture. Expressed in the nervous system and intestinal epithelium, EPHB2 regulates axon guidance, synaptic plasticity, and epithelial organization. Loss or dysregulation of EPHB2 contributes to colorectal cancer progression and altered neural connectivity, underscoring its central role in developmental patterning and tissue homeostasis.