EPO/Erythropoietin Monoclonal antibody, PBS Only

• 

  WB analysis of Recombinant protein using 66975-1-Ig (same clone as 66975-1-PBS)

  50 ng recombinant human EPO (cat.NO. HZ-1168) was subjected to SDS-PAGE under reducing condition followed by western blot with 66975-1-Ig (EPO antibody) at dilution of 1:10000. This data was developed using the same antibody clone with 66975-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66975-1-Ig (same clone as 66975-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66975-1-Ig (EPO/Erythropoietin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66975-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66975-1-Ig (same clone as 66975-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66975-1-Ig (EPO/Erythropoietin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66975-1-Ig (same clone as 66975-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EPO antibody (66975-1-Ig, Clone: 1A11F3 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 66975-1-PBS in a different storage buffer formulation.

EPO/Erythropoietin Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66975-1-PBS

Clone No.1A11F3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EPO, MVCD2, erythropoietin, Epoetin, EP

---

Product Information

66975-1-PBS targets EPO/Erythropoietin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23054

  Product name: Recombinant human EPO protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 29-193 aa of BC093628

  Sequence: PPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

• Full Name: erythropoietin
• Calculated Molecular Weight: 193 aa, 21 kDa
• GenBank Accession Number: BC093628
• Gene Symbol: EPO/Erythropoietin
• Gene ID (NCBI): 2056
• RRID: AB_2882295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01588
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.