Use Able AI chat for product recommendations

EPOR Recombinant monoclonal antibody, PBS Only (Capture)

EPOR Uni-rAb® Recombinant Antibody for IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 83056-4-PBS
Clone No.230117G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Sandwich ELISA, Indirect ELISA

230117G3, EPO R, EPO-R, erythropoietin receptor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83056-4-PBS targets EPOR as part of a matched antibody pair:

MP00065-1: 83056-4-PBS capture and 83056-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33956

Product name: Recombinant human EPOR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-250 aa of NM_000121.4

Sequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Predict reactive species
Full Name erythropoietin receptor
Calculated Molecular Weight55 kDa
GenBank Accession NumberNM_000121.4
Gene Symbol EPOR
Gene ID (NCBI) 2057
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19235
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Erythropoietin (EPO) receptor (EPOR) is a glycoprotein that belongs to the type I superfamily of single-transmembrane cytokine receptors. It consists of an extracellular domain that binds to the EPO ligand, a transmembrane domain and an intracellular domain. The interaction of EPO and EPOR triggers the activation of several signaling pathways that induce erythropoiesis, including JAK2/STAT5, PI3K/AKT, and MAPK (PMID: 34281163). EPOR is present on erythroid progenitor cells and has also been detected on a wide variety of non-hematopoietic cells (PMID: 36233351).

Loading...
||
New chat

Able

正在加载,请稍候...