• Featured Product
  • KD/KO Validated

EPS15 Recombinant monoclonal antibody, PBS Only (Capture)

EPS15 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84179-1-PBS
Clone No.241485B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

241485B7, AF 1P, AF1P, MLLT5, Protein AF 1p

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84179-1-PBS targets EPS15 as part of a matched antibody pair:

MP01095-1: 84179-1-PBS capture and 84179-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35282

Product name: Recombinant human EPS15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 700-860 aa of NM_001981.3

Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK

Predict reactive species
Full Name epidermal growth factor receptor pathway substrate 15
Calculated Molecular Weight99 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberNM_001981.3
Gene Symbol EPS15
Gene ID (NCBI) 2060
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42566
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153).

Loading...
||
New chat

Able

正在加载,请稍候...