EPS15 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 84179-1-RR (same clone as 84179-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84179-1-RR (EPS15 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84179-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 84179-1-RR (same clone as 84179-1-PBS)

  WB result of EPS15 antibody (84179-1-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPS15 transfected MCF-7 cells. This data was developed using the same antibody clone with 84179-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01095-1

  Cytometric bead array standard curve of MP01095-1, EPS15 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84179-1-PBS. Detection antibody: 84179-4-PBS. Standard: Ag35282. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 84179-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 84179-1-PBS against Human EPS15 was performed. The affinity constant is 3.07 nM.

• 

  Affinity and Kinetic Characterization of 84179-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84179-1-RR against Human EPS15 were performed. The affinity constant is 2.72 nM.

• Featured Product
• KD/KO Validated

EPS15 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 84179-1-PBS

Clone No.241485B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

241485B7, AF 1P, AF1P, MLLT5, Protein AF 1p

---

Product Information

84179-1-PBS targets EPS15 as part of a matched antibody pair:

MP01095-1: 84179-1-PBS capture and 84179-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35282

  Product name: Recombinant human EPS15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 700-860 aa of NM_001981.3

  Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK

• Full Name: epidermal growth factor receptor pathway substrate 15
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_001981.3
• Gene Symbol: EPS15
• Gene ID (NCBI): 2060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42566
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153).