EPS15 Recombinant monoclonal antibody

• 

  WB analysis using 84179-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84179-1-RR (EPS15 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 84179-1-RR

  WB result of EPS15 antibody (84179-1-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPS15 transfected MCF-7 cells.

• 

  Affinity and Kinetic Characterization of 84179-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84179-1-RR against Human EPS15 were performed. The affinity constant is 2.72 nM.

• Featured Product
• KD/KO Validated

EPS15 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 84179-1-RR

Clone No.241485B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

241485B7, AF 1P, AF1P, MLLT5, Protein AF 1p

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, A431 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84179-1-RR targets EPS15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35282

  Product name: Recombinant human EPS15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 700-860 aa of NM_001981.3

  Sequence: VVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAK

• Full Name: epidermal growth factor receptor pathway substrate 15
• Calculated Molecular Weight: 99 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_001981.3
• Gene Symbol: EPS15
• Gene ID (NCBI): 2060
• RRID: AB_3671734
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42566
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EPS15 was originally identified as a substrate for the kinase activity of the epidermal growth factor receptor (EGFR). EPS15 has a tripartite structure comprising an NH2-terminal portion, which contains three EH domains, a central putative coiled-coil region, and a COOH-terminal domain containing multiple copies of the amino acid triplet Aspartate-Proline-Phenylalanine (PMID: 10481267). EPS15 is phosphorylated on tyrosine residues following EGFR activation (PMID: 7689153).