EPS15R Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPS15R Polyclonal antibody, PBS Only (21243-1-PBS)

• 

  WB analysis using 21243-1-AP (same clone as 21243-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21243-1-AP (EPS15R antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21243-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 21243-1-AP (same clone as 21243-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21243-1-AP (EPS15R antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 21243-1-AP (same clone as 21243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 21243-1-AP (EPS15R antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21243-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 21243-1-AP (same clone as 21243-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 21243-1-AP (EPS15R antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21243-1-PBS in a different storage buffer formulation.

• 

  IF Staining of BxPC-3 using 21243-1-AP (same clone as 21243-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed BxPC-3 cells using 21243-1-AP (EPS15R antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21243-1-PBS in a different storage buffer formulation.

EPS15R Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21243-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EPS15L1, Eps15-related protein, Eps15 related protein, Epidermal growth factor receptor substrate 15-like 1

---

Product Information

21243-1-PBS targets EPS15R in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15735

  Product name: Recombinant human EPS15L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-597 aa of BC142716

  Sequence: PQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAM

• Full Name: epidermal growth factor receptor pathway substrate 15-like 1
• Calculated Molecular Weight: 864 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC142716
• Gene Symbol: EPS15R
• Gene ID (NCBI): 58513
• RRID: AB_10733643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPS15R is a protein that belongs to the Eps15 family of proteins, which are known for their roles in intracellular trafficking, particularly in the regulation of endocytosis and vesicle formation. EPS15R, like other members of the Eps15 family, functions as a scaffolding adaptor protein and is involved in both secretion and endocytosis. It has been shown to bind to AP-1 and AP-2 complexes, inositol lipids, and several other proteins that are crucial for the regulation of intracellular trafficking. EPS15R is also implicated in the regulation of membrane morphology, which is essential for intracellular vesicle formation and trafficking . It has been detected in the nucleus of mammalian cells, and its activation through growth factor receptors induces tyrosine phosphorylation and mono-ubiquitination, although the specific roles of these post-translational modifications are not yet fully understood