EPS8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EPS8 Polyclonal antibody (12455-1-AP)

• Featured Product
• KD/KO Validated

EPS8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12455-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Epidermal growth factor receptor kinase substrate 8

• 

  WB analysis using 12455-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12455-1-AP (EPS8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12455-1-AP

  WB result of EPS8 antibody (12455-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EPS8 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12455-1-AP

  IP result of anti-EPS8 (IP:12455-1-AP, 3ug; Detection:12455-1-AP 1:500) with HeLa cells lysate 3800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 12455-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12455-1-AP (EPS8 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 12455-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12455-1-AP (EPS8 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 12455-1-AP

  Immunofluorescent analysis of A375 cells using 12455-1-AP (EPS8 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EPS8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12455-1-AP targets EPS8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3121

  Product name: Recombinant human EPS8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-267 aa of BC030010

  Sequence: GMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARID

• Full Name: epidermal growth factor receptor pathway substrate 8
• Calculated Molecular Weight: 822 aa, 92 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC030010
• Gene Symbol: EPS8
• Gene ID (NCBI): 2059
• RRID: AB_2098836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Epidermal growth factor receptor Pathway Substrate 8 (EPS8) is a crucial regulator of the actin cytoskeleton dynamics accompanying cell motility and invasion. This protein contains one PH domain and one SH3 domain leading to its binding activity with multiple cellular targets. EPS8 can function as a unique actin capping protein specifically required for dendritic cell migration and plays roles in the regulation of axonal filopodia in neuronal development and synapse formation. The EPS8 gene may contribute to the development of a subset of colorectal cancers and could have applications in diagnosis and treatment.

Publications

What published studies show

The EPS8 polyclonal antibody (Cat# 12455-1-AP) has 4 total citations published in Nature Aging, Acta Biochimica et Biophysica Sinica, Experimental Cell Research, and Acta Otolaryngologica. The associated research fields include aging and protein aggregation via RAC signaling, gastric cancer (miR-345/Rac1 axis), pancreatic cancer (BMI1/ALDH7A1 pathway), and auditory hair cell biology (myosin XVa structure/function).

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Aging; The aging factor EPS8 induces disease-related protein aggregation through RAC signaling hyperactivation.; Authors - Seda Koyuncu ; KD Validated
human	WB	Acta Biochim Biophys Sin (Shanghai); miR-345 inhibits migration and stem-like cell phenotype in gastric cancer via inactivation of Rac1 by targeting EPS8.; Authors - Jieyun Zhang ; KD Validated
human	WB,IHC	Exp Cell Res; EPS8 supports pancreatic cancer growth by inhibiting BMI1 mediated proteasomal degradation of ALDH7A1.; Authors - Mingzhu Tan ; KD Validated
mouse	WB	Acta Otolaryngol; The 133-kDa N-terminal region of myosin XVa is critical for normal structure and function of auditory and hair cells; Authors - Yong Li