EPYC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EPYC Polyclonal antibody, PBS Only (16626-1-PBS)

• 

  WB analysis of L02 using 16626-1-AP (same clone as 16626-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 16626-1-AP (EPYC antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16626-1-PBS in a different storage buffer formulation.

EPYC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16626-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Synonyms

DSPG3, epiphycan, Pg Lb, PGLB, PG-Lb

---

Product Information

16626-1-PBS targets EPYC in applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9929

  Product name: Recombinant human EPYC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-322 aa of BC030958

  Sequence: ESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV

• Full Name: epiphycan
• Calculated Molecular Weight: 322 aa, 37 kDa
• Observed Molecular Weight: 37kDa, 62 kDa
• GenBank Accession Number: BC030958
• Gene Symbol: EPYC
• Gene ID (NCBI): 1833
• RRID: AB_3741890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99645
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EPYC (Epiphycan), also known as DSPG3. It is demonstrated that DSPG3 is expressed in cartilage, as well as ligament and placental tissues (PMID: 8975717). May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization. The molecular weight of EPYC is 37 kDa, it is also reported the molecular weight is 62 kDa (PMID: 38184732).