• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ERAB Monoclonal antibody

ERAB Monoclonal Antibody for
Cat No. CL488-60069
Clone No.1G5E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

HSD17B10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, 3alpha(or 20beta)-hydroxysteroid dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-60069 targets ERAB in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1020

Product name: Recombinant human HSD17B10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-252 aa of BC008708

Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Predict reactive species
Full Name hydroxysteroid (17-beta) dehydrogenase 10
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC008708
Gene Symbol ERAB
Gene ID (NCBI) 3028
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99714
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).

Loading...
||
New chat Able
正在加载,请稍候...