ERAP2 Monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 67477-1-Ig (same clone as 67477-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67477-1-Ig (ERAP2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67477-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67477-1-Ig (same clone as 67477-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67477-1-Ig (ERAP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67477-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67477-1-Ig (same clone as 67477-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67477-1-Ig (ERAP2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67477-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67477-1-Ig (same clone as 67477-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67477-1-Ig (ERAP2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67477-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67477-1-Ig (same clone as 67477-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67477-1-Ig (ERAP2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67477-1-PBS in a different storage buffer formulation.

ERAP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67477-1-PBS

Clone No.2B11A2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat

Applications

WB, Indirect ELISA

Synonyms

ERAP2, FLJ23633, FLJ23701, FLJ23807, L RAP, LRAP

---

Product Information

67477-1-PBS targets ERAP2 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30061

  Product name: Recombinant human ERAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 41-180 aa of BC065240

  Sequence: PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY

• Full Name: endoplasmic reticulum aminopeptidase 2
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC065240
• Gene Symbol: ERAP2
• Gene ID (NCBI): 64167
• RRID: AB_2882704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6P179
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ERAP2(Endoplasmic reticulum aminopeptidase 2) is also named as LRAP(Leukocyte-derived arginine aminopeptidase). It plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. ERAP2 can form heterodimers with ERAP1(PMID:15908954). Defects in the expression of ERAP2 may cause improper antigen processing, possibly leading to favor tumor escape from the immune surveillance. ERAP2 has the calculated molecular mass of 105-110 kDa, and apparent molecular mass of 120 kDa duo to the glycosylation.