ERAP2 Monoclonal antibody, PBS Only

ERAP2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67477-1-PBS
Clone No.2B11A2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat

Applications

WB, Indirect ELISA

ERAP2, FLJ23633, FLJ23701, FLJ23807, L RAP, LRAP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67477-1-PBS targets ERAP2 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30061

Product name: Recombinant human ERAP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 41-180 aa of BC065240

Sequence: PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY

Predict reactive species
Full Name endoplasmic reticulum aminopeptidase 2
Calculated Molecular Weight 110 kDa
Observed Molecular Weight 110-120 kDa
GenBank Accession NumberBC065240
Gene Symbol ERAP2
Gene ID (NCBI) 64167
RRIDAB_2882704
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6P179
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ERAP2(Endoplasmic reticulum aminopeptidase 2) is also named as LRAP(Leukocyte-derived arginine aminopeptidase). It plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. ERAP2 can form heterodimers with ERAP1(PMID:15908954). Defects in the expression of ERAP2 may cause improper antigen processing, possibly leading to favor tumor escape from the immune surveillance. ERAP2 has the calculated molecular mass of 105-110 kDa, and apparent molecular mass of 120 kDa duo to the glycosylation.

Loading...
||
New chat Able
正在加载,请稍候...