Product Information
15974-1-PBS targets ERH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8761 Product name: Recombinant human ERH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014301 Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Predict reactive species |
| Full Name | enhancer of rudimentary homolog (Drosophila) |
| Calculated Molecular Weight | 104 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC014301 |
| Gene Symbol | ERH |
| Gene ID (NCBI) | 2079 |
| RRID | AB_2098556 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84090 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |













