ERH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ERH Polyclonal antibody, PBS Only (15974-1-PBS)

• 

  WB analysis using 15974-1-AP (same clone as 15974-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15974-1-AP (same clone as 15974-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 15974-1-AP (same clone as 15974-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15974-1-AP (ERH antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15974-1-AP (same clone as 15974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15974-1-AP (ERH antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15974-1-AP (same clone as 15974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15974-1-AP (ERH antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15974-1-AP (same clone as 15974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15974-1-AP (ERH antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15974-1-AP (same clone as 15974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15974-1-AP (ERH antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15974-1-PBS in a different storage buffer formulation.

ERH Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15974-1-PBS targets ERH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8761

  Product name: Recombinant human ERH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC014301

  Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

• Full Name: enhancer of rudimentary homolog (Drosophila)
• Calculated Molecular Weight: 104 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC014301
• Gene Symbol: ERH
• Gene ID (NCBI): 2079
• RRID: AB_2098556
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84090
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.