ERLIN2 Polyclonal antibody

• 

  WB analysis of HeLa using 14781-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14781-1-AP (ERLIN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14781-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14781-1-AP (ERLIN2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 14781-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14781-1-AP (ERLIN2 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver cancer using 14781-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14781-1-AP (ERLIN2 Antibody) at dilution of 1:200 (under 10x lens).

ERLIN2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14781-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C8orf2, ER lipid raft associated 2, Erlin 2, ERLIN2, NET32, SPFH2

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

14781-1-AP targets ERLIN2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6369

  Product name: Recombinant human ERLIN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 23-206 aa of BC067765

  Sequence: VHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFGKKVSPEHAVLKQGSWNPASLHCLKPGCLQGVMVTYGQEMLKNLVLRSWSQRSSWRMLIAMQQDP

• Full Name: ER lipid raft associated 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC067765
• Gene Symbol: ERLIN2
• Gene ID (NCBI): 11160
• RRID: AB_2098859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94905
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ERLIN2, also named as C8orf2 and SPFH2, is a component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs) such as ITPR1 (PubMed:19240031, PubMed:17502376). It promotes sterol-accelerated ERAD of HMGCR probably implicating an AMFR/gp78-containing ubiquitin ligase complex (PubMed:21343306). ERLIN2 is involved in regulation of cellular cholesterol homeostasis by regulation the SREBP signaling pathway. The MW of ERLIN1/ERLIN2 complex is about 70 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS Genet; Disruption of the ERLIN-TM6SF2-APOB complex destabilizes APOB and contributes to non-alcoholic fatty liver disease.; Authors - Bo-Tao Li
human	WB	iScience; The SARS-CoV-2 protein ORF3c is a mitochondrial modulator of innate immunity; Authors - Hazel Stewart
Human	IHC	Oncogene; Dual network analysis of transcriptome data for discovery of new therapeutic targets in non-small cell lung cancer; Authors - Yuquan Bai