ERP29 Monoclonal antibody

• 

  WB analysis using 67675-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67675-1-Ig (ERP29 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 67675-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67675-1-Ig (ERP29 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 67675-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67675-1-Ig (ERP29 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 67675-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67675-1-Ig (ERP29 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 67675-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 67675-1-Ig (ERP29 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human kidney using 67675-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using ERP29 antibody (67675-1-Ig, Clone: 1H8B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human kidney using 67675-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using ERP29 antibody (67675-1-Ig, Clone: 1H8B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

ERP29 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67675-1-Ig

Clone No.1H8B2

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

C12orf8, ERp28, ERP29, ERp31, PDI DB, PDIA9

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67675-1-Ig targets ERP29 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30262

  Product name: Recombinant human ERP29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 40-261 aa of BC101495

  Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

• Full Name: endoplasmic reticulum protein 29
• Calculated Molecular Weight: 261 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC101495
• Gene Symbol: ERP29
• Gene ID (NCBI): 10961
• RRID: AB_2882870
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30040
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Cell Biol; Competition for calnexin binding regulates secretion and turnover of misfolded GPI-anchored proteins; Authors - Amber M Cheatham