CoraLite® Plus 488-conjugated ERP29 Monoclonal antibody

ERP29 Monoclonal Antibody for IF-P
Cat No. CL488-67675
Clone No.1H8B2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

IF-P

C12orf8, ERp28, ERP29, ERp31, PDI DB, PDIA9

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman kidney tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67675 targets ERP29 in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30262

Product name: Recombinant human ERP29 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 40-261 aa of BC101495

Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

Predict reactive species
Full Name endoplasmic reticulum protein 29
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight29 kDa
GenBank Accession NumberBC101495
Gene Symbol ERP29
Gene ID (NCBI) 10961
RRIDAB_2919516
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30040
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Endoplasmic reticulum resident protein 29 (ERP29) is a 29-kDa endoplasmic reticulum (ER) luminal protein. Structurally ERp29 is related to protein disulfide isomerases (PDI). However, it lacks the thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase (PMID: 15500441). ERP29 plays an important role in the processing of secretory proteins within the (ER), possibly by participating in the folding of proteins in the ER. The secretion of thyroglobulin (TG) was found to be strongly regulated by ERP29 (PMID: 16380091).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ERP29 antibody CL488-67675Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...