ESAM Polyclonal antibody

• 

  WB analysis using 28739-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28739-1-AP (ESAM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ESAM Polyclonal Antibody for WB, ELISA

Cat No. 28739-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

Synonyms

ESAM, W117m

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28739-1-AP targets ESAM in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30233

  Product name: Recombinant human ESAM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 30-248 aa of BC016868

  Sequence: QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

• Full Name: endothelial cell adhesion molecule
• Calculated Molecular Weight: 390 aa, 41 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC016868
• Gene Symbol: ESAM
• Gene ID (NCBI): 90952
• RRID: AB_2881203
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.