ESM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ESM1 Polyclonal antibody, PBS Only (12355-1-PBS)

• 

  WB analysis of HUVEC using 12355-1-AP (same clone as 12355-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 12355-1-AP (ESM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12355-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HUVEC using 12355-1-AP (same clone as 12355-1-PBS)

  IP result of anti-ESM1 (IP:12355-1-AP, 4ug; Detection:12355-1-AP 1:300) with HUVEC cells lysate 640 ug. This data was developed using the same antibody clone with 12355-1-PBS in a different storage buffer formulation.

ESM1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 12355-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

endocan, endothelial cell molecule 1, Endothelial cell specific molecule 1, Endothelial cell-specific molecule 1, ESM-1

---

Product Information

12355-1-PBS targets ESM1 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3019

  Product name: Recombinant human ESM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-184 aa of BC011989

  Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

• Full Name: endothelial cell-specific molecule 1
• Calculated Molecular Weight: 184 aa, 20 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC011989
• Gene Symbol: ESM1
• Gene ID (NCBI): 11082
• RRID: AB_3669137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ESM1 is a secreted protein mainly expressed in the endothelial cells. The deduced 184-amino acid protein is cysteine rich with an N-terminal hydrophobic signal sequence. Expression of ESM1 was tested by Northern blot analysis and RT-PCR and was found to be constitutive in a HUVEC cell line, but not in any other cell line tested. Constitutive ESM1 expression in human tissue was restricted to lung.