• Featured Product
  • KD/KO Validated

ESR2 Monoclonal antibody, PBS Only

ESR2 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60197-1-PBS
Clone No.5D2C9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

ER BETA, Erb, ERβ, ESR BETA, ESR2, ESRB, ESTRB, estrogen receptor 2 (ER beta), Estrogen receptor beta, NR3A2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60197-1-PBS targets ESR2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5103

Product name: Recombinant human ESR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-323 aa of BC024181

Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Predict reactive species
Full Name estrogen receptor 2 (ER beta)
Calculated Molecular Weight 59 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC024181
Gene Symbol ESR2
Gene ID (NCBI) 2100
RRIDAB_10897162
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92731
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoform and range of calculated molecular weight of isoforms is 50-60 kDa. The experiment detected two bands for ESR2 in isolated human germ cells, one at 60 kDa and a weaker one at 50 kDa (PMID: 14766008).

Loading...
||
New chat Able
正在加载,请稍候...