ESR2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ESR2 Monoclonal antibody (60197-1-Ig)

• Featured Product
• KD/KO Validated

ESR2 Monoclonal Antibody for WB, ELISA

Cat No. 60197-1-Ig Copied!

Clone No. 5D2C9

Publications (14)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA
For FC, select conjugated version.

Synonyms

5D2C9, ER BETA, Erb, ER-beta, ERβ

• 

  WB analysis of MCF-7 using 60197-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 60197-1-Ig (ESR2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SW 1990 using 60197-1-Ig

  SW 1990 cells were subjected to SDS PAGE followed by western blot with 60197-1-Ig (ESR2 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 60197-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 60197-1-Ig (ESR2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ESR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human brain tissue, SW 1990 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60197-1-Ig targets ESR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5103

  Product name: Recombinant human ESR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC024181

  Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

• Full Name: estrogen receptor 2 (ER beta)
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC024181
• Gene Symbol: ESR2
• Gene ID (NCBI): 2100
• RRID: AB_10897162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoform and range of calculated molecular weight of isoforms is 50-60 kDa. The experiment detected two bands for ESR2 in isolated human germ cells, one at 60 kDa and a weaker one at 50 kDa (PMID: 14766008).

Publications

What published studies show

ESR2 Monoclonal antibody (5D2C9), catalog number 60197-1-Ig, has 14 citations. These appear in journals including Environmental Pollution, Journal of Ethnopharmacology, Journal of Environmental Science, Inflammation, Biofactors, Toxicology, Journal of Molecular Medicine, BBA Molecular Cell Research, Journal of Cell Communication and Signaling, Endocrinology, Journal of Biochemical and Molecular Toxicology, Molecular Biology Reports, PeerJ, and Journal of Obstetrics and Gynaecology Research. Research fields span oncology, environmental toxicology, reproductive biology, neuroprotection, and pharmacology.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Environ Pollut; Betulinic acid alleviates zearalenone-induced uterine injury in mice; Authors - Chenglin Yang
human	IF	J Ethnopharmacol; Epigallocatechin promotes megakaryocyte differentiation via ERα-dependent SRC/PI3K/AKT signaling for thrombocytopenia treatment.; Authors - Miao Huang
human	IHC	J Environ Sci (China); Environmental microcystin exposure triggers the poor prognosis of prostate cancer: Evidence from case-control, animal, and in vitro studies; Authors - Chun Pan
mouse	WB,IHC,IF	Inflammation; High Dose of Estrogen Protects the Lungs from Ischemia-Reperfusion Injury by Downregulating the Angiotensin II Signaling Pathway; Authors - Peng Dai
human	WB,IF	Toxicology; Evaluation of toxicological effects of bisphenol S with an in vitro human bone marrow mesenchymal stem cell: Implications for bone health; Authors - Mei Li
mouse	WB	Biofactors; Propofol exerts neuroprotective functions by down-regulating microRNA-19a in glutamic acid-induced PC12 cells.; Authors - Shashuang Yu