ESYT1 Monoclonal antibody

• 

  WB analysis using 67688-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67688-1-Ig (ESYT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67688-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67688-1-Ig (FAM62A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67688-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67688-1-Ig (FAM62A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 67688-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using ESYT1 antibody (67688-1-Ig, Clone: 2C12E4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

ESYT1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67688-1-Ig

Clone No.2C12E4

Publications(2)

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

E Syt1, ESYT1, E-Syt1, Extended synaptotagmin 1, Extended synaptotagmin-1, FAM62A, KIAA0747, MBC2

---

Tested Applications

• Positive WB detected in: HepG2 cells, HSC-T6 cells, MOLT-4 cells, Jurkat cells, K-562 cells, THP-1 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

67688-1-Ig targets ESYT1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16840

  Product name: Recombinant human FAM62A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 755-1104 aa of BC004998

  Sequence: DVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLDRWFTLSSGQGQVLLRAQLGILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSAPELRQRLTHVDSPLEAPAGPLGQVKLTLWYYSEERKLVSIVHGCRSLRQNGRDPPDPYVSLLLLPDKNRGTKRRTSQKKRTLSPEFNERFEWELPLDEAQRRKLDVSVKSNSSFMSRERELLGKVQLDLAETDLSQGVARWYDLMDNKDKGSS

• Full Name: family with sequence similarity 62 (C2 domain containing), member A
• Calculated Molecular Weight: 1104 aa, 123 kDa
• Observed Molecular Weight: 123 kDa
• GenBank Accession Number: BC004998
• Gene Symbol: ESYT1
• Gene ID (NCBI): 23344
• RRID: AB_2882881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; The resealing factor S100A11 interacts with annexins and extended synaptotagmin-1 in the course of plasma membrane wound repair; Authors - Arsila P. K. Ashraf ; KD Validated
human	WB,IF	Nat Cell Biol; Sphingosine-1-phosphate signalling activates E-Syt1 to facilitate HDL-derived cholesterol transport; Authors - Zizhen Xu ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Shihab (Verified Customer) (09-17-2021)

This antibody was used in a western blot application to identify recombinant Esyt1 prescence. Using 1:500 at the first attempt, this antibody was able to successfully provide a band at the correct size. Furthermore, the band was clean which was an added bonus. I will be reducing the concentration of antibody used and also trying this antibody in other applications as well as primary cell lysate

• Applications: Western Blot
• Primary Antibody Dilution: 1:500 (will be reducing)
• Cell Tissue Type: HEK293 transfected with Esyt1