ESYT1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67688-1-Ig (same clone as 67688-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67688-1-Ig (ESYT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67688-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67688-1-Ig (same clone as 67688-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67688-1-Ig (FAM62A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67688-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67688-1-Ig (same clone as 67688-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67688-1-Ig (FAM62A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67688-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 67688-1-Ig (same clone as 67688-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using ESYT1 antibody (67688-1-Ig, Clone: 2C12E4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67688-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ESYT1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67688-1-PBS

Clone No.2C12E4

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IF/ICC, ELISA

Synonyms

FAM62A, Extended synaptotagmin-1, Extended synaptotagmin 1, E-Syt1, E Syt1

---

Product Information

67688-1-PBS targets ESYT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16840

  Product name: Recombinant human FAM62A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 755-1104 aa of BC004998

  Sequence: DVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLDRWFTLSSGQGQVLLRAQLGILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSAPELRQRLTHVDSPLEAPAGPLGQVKLTLWYYSEERKLVSIVHGCRSLRQNGRDPPDPYVSLLLLPDKNRGTKRRTSQKKRTLSPEFNERFEWELPLDEAQRRKLDVSVKSNSSFMSRERELLGKVQLDLAETDLSQGVARWYDLMDNKDKGSS

• Full Name: family with sequence similarity 62 (C2 domain containing), member A
• Calculated Molecular Weight: 1104 aa, 123 kDa
• Observed Molecular Weight: 123 kDa
• GenBank Accession Number: BC004998
• Gene Symbol: ESYT1
• Gene ID (NCBI): 23344
• RRID: AB_2882881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSJ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.