ETV1 Polyclonal antibody

• 

  WB analysis using 28197-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28197-1-AP (ETV1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

ETV1 Polyclonal Antibody for WB, ELISA

Cat No. 28197-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

ER81, ETS translocation variant 1, Ets-related protein 81

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28197-1-AP targets ETV1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28158

  Product name: Recombinant human ETV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-213 aa of BC098403

  Sequence: VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR

• Full Name: ets variant 1
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC098403
• Gene Symbol: ETV1
• Gene ID (NCBI): 2115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50549
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ETV1(Ets variant 1) is a member of ETS transcription factor family, which has become the research focus in cancer and cardiac electrophysiology in recent years. TMPRSS2-ETV1 gene fusion exists in about 1-2% of prostate cancer, while ETV1 is highly expressed in 5-10% of advanced tumors. Different from sibling factor ERG, ETV1 not only enhances the signal of androgen receptor (AR), but also can autonomously activate testosterone synthesis and cholesterol/lipid metabolism reprogramming, cooperate with PTEN deficiency to promote the progress of local cancer to invasive adenocarcinoma, and predict higher Gleason score and poor prognosis, so it is regarded as an invasive subtype marker of "metabolism-transcription dual drive".