ETV3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ETV3 Polyclonal antibody, PBS Only (11721-1-PBS)

• 

  WB analysis using 11721-1-AP (same clone as 11721-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11721-1-AP (ETV3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11721-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 11721-1-AP (same clone as 11721-1-PBS)

  IP result of anti-ETV3 (IP:11721-1-AP, 4ug; Detection:11721-1-AP 1:500) with HepG2 cells lysate 1440 ug. This data was developed using the same antibody clone with 11721-1-PBS in a different storage buffer formulation.

ETV3 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 11721-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

ets variant 3, ETV 3, PE-1

---

Product Information

11721-1-PBS targets ETV3 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2301

  Product name: Recombinant human ETV3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-143 aa of BC022868

  Sequence: MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN

• Full Name: ets variant 3
• Calculated Molecular Weight: 512 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC022868
• Gene Symbol: ETV3
• Gene ID (NCBI): 2117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41162
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ETV3 is a transcriptional repressor that belongs to the ETS family of transcription factors, which bind a common DNA sequence core motif (GGAA) via their ETS domains. ETV3 is preferentially expressed in mature DC including tissue-derived migratory DC (migDC) and facilitates their homeostatic maturation and CCR7-dependent migration. Phosphorylation of ETV3 regulated transcription by preventing its binding to DNA at promoters for several thousand genes, including some involved in negative feedback regulation of itself and of upstream signals (PMID: 36543959, 41678619). Western and IP analysis detected the specific band with an apparent MW of 57 kDa.