EVI2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EVI2A Polyclonal antibody, PBS Only (17415-1-PBS)

• 

  WB analysis of human brain using 17415-1-AP (same clone as 17415-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17415-1-AP (EVI2A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17415-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 17415-1-AP (same clone as 17415-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17415-1-AP (EVI2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17415-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17415-1-AP (same clone as 17415-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17415-1-AP (EVI2A antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17415-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17415-1-AP (same clone as 17415-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17415-1-AP (EVI2A antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17415-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17415-1-AP (same clone as 17415-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EVI2A antibody (17415-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17415-1-PBS in a different storage buffer formulation.

EVI2A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17415-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EVI-2A, EVI2, EVI 2A, EVDA

---

Product Information

17415-1-PBS targets EVI2A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11075

  Product name: Recombinant human EVI2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC035572

  Sequence: MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG

• Full Name: ecotropic viral integration site 2A
• Calculated Molecular Weight: 236 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC035572
• Gene Symbol: EVI2A
• Gene ID (NCBI): 2123
• RRID: AB_2101143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22794
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.