EVI2B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85943-1-RR (same clone as 85943-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85943-1-RR (EVI2B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85943-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 85943-1-RR (same clone as 85943-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using EVI2B antibody (85943-1-RR, Clone: 250344C9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85943-1-PBS in a different storage buffer formulation.

EVI2B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85943-1-PBS

Clone No.250344C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CD361, D17S376, EVDB, EVI 2B, EVI-2B

---

Product Information

85943-1-PBS targets EVI2B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3709

  Product name: Recombinant Human EVI2B protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-202 aa of BC005926

  Sequence: KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS

• Full Name: ecotropic viral integration site 2B
• Calculated Molecular Weight: 448 aa, 49 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC005926
• Gene Symbol: EVI2B
• Gene ID (NCBI): 2124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P34910
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ecotropic viral integration site 2B protein (EVI2B) is a type I transmembrane protein embedded within intron 27b of the neurofibromatosis type 1 (NF1) gene. It is transcribed in the opposite direction to the NF1 gene (PMID: 37584733). EVI2B is a downstream target of CCAAT/enhancer binding protein alpha (C/EBPα), which is crucial for myeloid differentiation and the function of hematopoietic progenitors (PMID: 36830696). This protein is highly expressed in mature granulocytes and is involved in the regulation of immune cell maturation (PMID: 28186500).