CoraLite® Plus 488-conjugated EVI2B Recombinant monoclonal antibody

EVI2B Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85943
Clone No.250344C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CD361, D17S376, EVDB, EVI 2B, EVI-2B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85943 targets EVI2B in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3709

Product name: Recombinant Human EVI2B protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-202 aa of BC005926

Sequence: KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS

Predict reactive species
Full Name ecotropic viral integration site 2B
Calculated Molecular Weight 448 aa, 49 kDa
GenBank Accession NumberBC005926
Gene Symbol EVI2B
Gene ID (NCBI) 2124
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP34910
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ecotropic viral integration site 2B protein (EVI2B) is a type I transmembrane protein embedded within intron 27b of the neurofibromatosis type 1 (NF1) gene. It is transcribed in the opposite direction to the NF1 gene (PMID: 37584733). EVI2B is a downstream target of CCAAT/enhancer binding protein alpha (C/EBPα), which is crucial for myeloid differentiation and the function of hematopoietic progenitors (PMID: 36830696). This protein is highly expressed in mature granulocytes and is involved in the regulation of immune cell maturation (PMID: 28186500).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EVI2B antibody CL488-85943Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...