EXOSC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EXOSC3 Polyclonal antibody, PBS Only (15062-1-PBS)

• 

  WB analysis using 15062-1-AP (same clone as 15062-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15062-1-AP (EXOSC3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15062-1-AP (same clone as 15062-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15062-1-AP (EXOSC3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A2780 using 15062-1-AP (same clone as 15062-1-PBS)

  IP result of anti-EXOSC3 (IP:15062-1-AP, 4ug; Detection:15062-1-AP 1:500) with A2780 cells lysate 800ug. This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15062-1-AP (same clone as 15062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15062-1-AP (EXOSC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 15062-1-AP (same clone as 15062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15062-1-AP (EXOSC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 15062-1-AP (same clone as 15062-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using EXOSC3 antibody (15062-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 15062-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EXOSC3 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 15062-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15062-1-PBS targets EXOSC3 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7065

  Product name: Recombinant human EXOSC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC002437

  Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

• Full Name: exosome component 3
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC002437
• Gene Symbol: EXOSC3
• Gene ID (NCBI): 51010
• RRID: AB_2278183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQT5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNA exosomes are multi-subunit complexes conserved throughout evolution, and they are emerging as the major cellular machinery for processing, surveillance and turnover of a diverse spectrum of coding and noncoding RNA substrates essential for viability[PMID:22544365]. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts [PMID:11782436]. EXOSC3 is a non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of Rnase PH-domain subunits through contacts with EXOSC9 and EXOSC5 [PMID:21255825].