CoraLite® Plus 488-conjugated EXOSC6 Recombinant monoclonal antibody

EXOSC6 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84346-2
Clone No.241535G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

241535G9, EAP4, exosome component 6, hMtr3, hMtr3p

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84346-2 targets EXOSC6 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33513

Product name: Recombinant human EXOSC6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-272 aa of NM_058219

Sequence: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP

Predict reactive species
Full Name exosome component 6
Calculated Molecular Weight28kd
Observed Molecular Weight28-32 kDa
GenBank Accession NumberNM_058219
Gene Symbol EXOSC6
Gene ID (NCBI) 118460
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5RKV6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

EXOSC6 (exosome component 6), also known as p11 or MTR3. The calculated molecular weight of EXOSC6 is 28 kDa. And it has low tissue specificity. The gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. It is also a component of the RNA exosome complex (PMID: 29906447). The composition of human exosome is similar to its yeast counterpart. EXOSC6 is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 EXOSC6 antibody CL488-84346-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...