EYA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EYA2 Polyclonal antibody, PBS Only (11314-1-PBS)

• 

  WB analysis using 11314-1-AP (same clone as 11314-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11314-1-AP (EYA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11314-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11314-1-AP (same clone as 11314-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11314-1-AP (EYA2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11314-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11314-1-AP (same clone as 11314-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using EYA2 antibody (11314-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11314-1-PBS in a different storage buffer formulation.

EYA2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11314-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:3.1.3.48, EAB1

---

Product Information

11314-1-PBS targets EYA2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1860

  Product name: Recombinant human EYA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-583 aa of BC013882

  Sequence: LSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL

• Full Name: eyes absent homolog 2 (Drosophila)
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 56 kDa and 70 kDa
• GenBank Accession Number: BC013882
• Gene Symbol: EYA2
• Gene ID (NCBI): 2139
• RRID: AB_10733651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00167
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EYA2, also named EAB1, belongs to the HAD-like hydrolase superfamily and EYA family. It coactivates SIX1. The Six1-EYA2 interaction may inhibit breast cancer progression. EYA2 is required for Six1-activated TGF-beta signaling.(PMID:21706047) It may be involved in the development of the eye. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 59 kDa, 57 kDa, and 50 kDa. It can be detected two bands of 70 kDa and 56 kDa in the neuroblastoma cells by western blot(PMID:12039049).