Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EZH2 Polyclonal antibody, PBS Only

EZH2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 21800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1, EZH1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


This antibody is not recommended for use in IHC.

Product Information

21800-1-PBS targets EZH2 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16789

Product name: Recombinant human EZH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-261 aa of BC010858

Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

Predict reactive species
Full Name enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight 751 aa, 86 kDa
Observed Molecular Weight 90-102 kDa
GenBank Accession NumberBC010858
Gene Symbol EZH2
Gene ID (NCBI) 2146
RRIDAB_10858790
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15910
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)

Loading...
||
New chat

Able

正在加载,请稍候...