EZH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• EZH2 Polyclonal antibody, PBS Only (21800-1-PBS)

• 

  WB analysis using 21800-1-AP (same clone as 21800-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of DU 145 using 21800-1-AP (same clone as 21800-1-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 21800-1-AP (same clone as 21800-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21800-1-AP (same clone as 21800-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 21800-1-AP (same clone as 21800-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 21800-1-AP (same clone as 21800-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 21800-1-AP (same clone as 21800-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 21800-1-AP (same clone as 21800-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21800-1-AP (same clone as 21800-1-PBS)

  Jurkat cell lysates were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 21800-1-AP (same clone as 21800-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 21800-1-AP (EZH2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 21800-1-AP (same clone as 21800-1-PBS)

  IP result of anti-EZH2 (IP:21800-1-AP, 4ug; Detection:21800-1-AP 1:1000) with HepG2 cells lysate 3400ug. This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung squamous cell carcinoma using 21800-1-AP (same clone as 21800-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 21800-1-AP (EZH2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 21800-1-AP (same clone as 21800-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21800-1-AP (EZH2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 21800-1-AP (same clone as 21800-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 21800-1-AP (EZH2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 21800-1-AP (same clone as 21800-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 21800-1-AP (EZH2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21800-1-AP (same clone as 21800-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EZH2 antibody (21800-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 21800-1-AP (same clone as 21800-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human EZH2 (21800-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 21800-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EZH2 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 21800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

EC:2.1.1.356, Enhancer of zeste homolog 2, ENX 1, ENX-1, EZH1

---

This antibody is not recommended for use in IHC.

Product Information

21800-1-PBS targets EZH2 in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16789

  Product name: Recombinant human EZH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 158-261 aa of BC010858

  Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT

• Full Name: enhancer of zeste homolog 2 (Drosophila)
• Calculated Molecular Weight: 751 aa, 86 kDa
• Observed Molecular Weight: 90-102 kDa
• GenBank Accession Number: BC010858
• Gene Symbol: EZH2
• Gene ID (NCBI): 2146
• RRID: AB_10858790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15910
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)